PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG760600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 454aa    MW: 49214.1 Da    PI: 6.7425
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG760600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4063.5e-124504481374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal.ppsetseknsseelaalklfsevsP 89 
                          l++lLl+cA a ++g l +a+a+L+++  la+pdgd+mqR+aa f+eALa+r +r +++l++al  p++++    +e +aa++ f +++P
  Pavir.5KG760600.1.p  50 LIHLLLNCAAAAAAGRLDAANAALEHIASLAAPDGDAMQRVAAAFAEALARRALRAWPGLCRALlLPRAAP--AAAELAAARRHFLDLCP 137
                          689************************************************************95455544..68999999999****** PP

                 GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefn 179
                          +l+++  +aNq Ilea+e+e++vH++D++    +QW+ Ll+ La+Rpegpp+lR+T+v++    +k+ l +t+  Lak Ae+l+vpf+fn
  Pavir.5KG760600.1.p 138 FLRLAGAAANQSILEAMESEKMVHVVDLGGADATQWLELLHLLAARPEGPPHLRLTAVHE----HKDVLTQTAMVLAKEAERLDVPFQFN 223
                          ************************************************************....9************************* PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrll................................desvsleserdevLklvkslsPk 237
                          + v+ rle+l++e+Lrvk+gEalaV ++lqlh ll                                    +++s+ d++L ++++lsPk
  Pavir.5KG760600.1.p 224 P-VVCRLEALDVESLRVKTGEALAVTSSLQLHCLLasdddsngskdsssndkgerrvkyrsspesgsG-VSPSTSRADAFLGALWGLSPK 311
                          *.6899********************************************************998642.333444689************ PP

                 GRAS 238 vvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpv 327
                          v vv+eqea+hn++ + erf+eal+yy+alfd+le+ ++r s er+ vEr llg+ei+n+vaceg errerhe+le+W +r+e aGF  v
  Pavir.5KG760600.1.p 312 VTVVTEQEASHNAAALTERFVEALNYYAALFDCLEVVAARGSVERARVERWLLGEEIKNIVACEGGERRERHERLERWAARMEGAGFARV 401
                          ****************************************************************************************** PP

                 GRAS 328 plsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                          pls++a  qa++  +    dg++v e++gs++l+W+dr+++svSaWr
  Pavir.5KG760600.1.p 402 PLSYYALLQARRAAQGLCCDGFKVREDKGSFFLCWQDRAIFSVSAWR 448
                          **********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.2624428IPR005202Transcription factor GRAS
PfamPF035141.2E-12150448IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MVQDEASSSS VTSSPLHNLS SHTMPLHPAA APTPPWLLRE LRSDERGLCL IHLLLNCAAA  60
AAAGRLDAAN AALEHIASLA APDGDAMQRV AAAFAEALAR RALRAWPGLC RALLLPRAAP  120
AAAELAAARR HFLDLCPFLR LAGAAANQSI LEAMESEKMV HVVDLGGADA TQWLELLHLL  180
AARPEGPPHL RLTAVHEHKD VLTQTAMVLA KEAERLDVPF QFNPVVCRLE ALDVESLRVK  240
TGEALAVTSS LQLHCLLASD DDSNGSKDSS SNDKGERRVK YRSSPESGSG VSPSTSRADA  300
FLGALWGLSP KVTVVTEQEA SHNAAALTER FVEALNYYAA LFDCLEVVAA RGSVERARVE  360
RWLLGEEIKN IVACEGGERR ERHERLERWA ARMEGAGFAR VPLSYYALLQ ARRAAQGLCC  420
DGFKVREDKG SFFLCWQDRA IFSVSAWRGR RLD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-48504484375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.49010.0callus| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9565700.0EU956570.1 Zea mays clone 1566913 GRAS family transcription factor containing protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456925.10.0hypothetical protein SORBIDRAFT_03g045660
SwissprotQ9LPR81e-165SCL3_ARATH; Scarecrow-like protein 3
TrEMBLC5XHT90.0C5XHT9_SORBI; Putative uncharacterized protein Sb03g045660
STRINGSb03g045660.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.11e-104scarecrow-like 3